>
产品中心 >
Two_Hybrid_Systems >
Gentarget/h KRAS (G12V) inducible lentiviral particles/LVP799/1 Ea

This Pre-made optional inducible lentiviral particles expresses the mutant human target, KRAS (G12V): Kirsten rat sarcoma viral oncogene homolog (alternative name: C-K-RAS; CFC2; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; NS; NS3; RASK2 ). This lentivirus express the mutant version of KRAS (with mutation site at G12V) with a N-terminal HA tag. The expressed protein sequence is listed as follows:
m-ypydvpdya-teyklvvvgaVgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagqeeysamrdqymrtgegflcvf
ainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreir
khkekmskdgkkkkkksktkcvim*
(Note: Yellow highlighted is the HA tag, the red “V” is the mutation site.)
The mutant KRAS (G12V) is expressed under an optional inducible suCMV promoter. This lentivirus can be used for regular constitutive high expression (without any induction) or used for inducible expression with tetracycline or Dox induction when the tetracycline repressor protein (TetR) is present.
A Blasticidin-RFP fusion dual marker under the RSV promoter allows fluorescence sorting or blasticidin resistance selection of transduced cells. The RFP signal additionally provides convenient, real-time monitoring of the particles’ performance. (see related products: CAT#: LVP799-GP and LVP762).
Each Lentivirus is validated on lot-by-lot basis, and target expression is guaranteed. See Product Manual for details (.pdf).
Amount: 200ul, at 1 x 107 IFU/ml in DMEM medium with 10% FBS and 10x of polybrene (60 ug/ml). (Note: When specifically requested, the concentrated particles can be provided at 1 x 108 IFU/ml in 200ul PBS solution for $650.00 USD).
Cat#: LVP799